PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.K02806.1.p
Common NameEUGRSUZ_K02806, LOC104426233
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 350aa    MW: 39375.2 Da    PI: 6.3914
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.K02806.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.36.5e-171259148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g W++eEde+l +++ ++G g+W+++++  g+ R++k+c++rw +yl
  Eucgr.K02806.1.p 12 KGLWSPEEDEKLFNYISRHGLGCWSSVPKLAGLQRCGKSCRLRWINYL 59
                      678*******************************************97 PP

2Myb_DNA-binding475.9e-1565109147
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       rg ++++E++l++ +++ lG++ W+ Ia  ++ gRt++++k++w++y
  Eucgr.K02806.1.p  65 RGMFSQQEEDLIITLHAALGNR-WAQIATQLP-GRTDNEIKNFWNSY 109
                       788*******************.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.4E-24662IPR009057Homeodomain-like
PROSITE profilePS5129417.921759IPR017930Myb domain
SuperFamilySSF466898.61E-2910106IPR009057Homeodomain-like
SMARTSM007171.1E-121161IPR001005SANT/Myb domain
PfamPF002491.8E-151259IPR001005SANT/Myb domain
CDDcd001673.03E-111559No hitNo description
PROSITE profilePS5129424.33660114IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.0E-2463114IPR009057Homeodomain-like
SMARTSM007178.0E-1464112IPR001005SANT/Myb domain
PfamPF002494.4E-1465109IPR001005SANT/Myb domain
CDDcd001675.22E-1068110No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 350 aa     Download sequence    Send to blast
MARSSCNQKL RKGLWSPEED EKLFNYISRH GLGCWSSVPK LAGLQRCGKS CRLRWINYLR  60
PDLKRGMFSQ QEEDLIITLH AALGNRWAQI ATQLPGRTDN EIKNFWNSYV RKKLTKQGID  120
PVTHKPLREL NSMSENCVEI EAAQALQEFK GSRDISSLRA KEPAFPIDGM HGGPMESPVG  180
EVFLNRALFD PSSSLEFHNA INPVLHGAKS RLVDPGYFEM NAAPFSSVSS SMEIDHENKN  240
TSGNLVSRMS CLFFHEAKKY CSNSSNNISN NTEFQLNSAA ENKDLPWADD EELDPLHQFQ  300
VNVTGSEDLK SISWQEEHLL AHAAVDFHGN HPSMSLSDDQ ILQAHFNIF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-27711422128MYB TRANSFORMING PROTEIN
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.K02806.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU0845049e-50EU084504.1 Acca sellowiana clone Ase31 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010037524.10.0PREDICTED: transcription factor MYB46-like
TrEMBLA0A059A5X50.0A0A059A5X5_EUCGR; Uncharacterized protein
STRINGPOPTR_0015s09430.11e-100(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.12e-76myb domain protein 86